• PRODUCT AVAILABILITY: Did you know you can view a product's availability right on the product page? Simply enter the quantity you want to purchase and the current availability will appear below the item.

  • Product is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile. If you do not have a Thomas Business Account, please Contact Us and someone will respond with details on how to apply for a business account with us.

EZBiolab

FITC Labeled ß-Amyloid Peptide 1-40

Not yet rated

NOTE: Due to special handling or shipping requirements, these products will have additional fees added during checkout. Click HERE for a description of what fees might be charged.

  • The purity of every peptide is > 95% or higher , determined by HPLC
  • A product report including Mass and HPLC spectra of each peptide is included in shipping
  • All peptides are shipped in lyophilized powder
  • Quality is guaranteed

Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Please Enter Your Order Info

Filter by:

  • Clear Filters
Product Detail
Thomas No.
C850X05
Mfr. No.
amp40-f
Description
FITC Labeled ß-Amyloid Peptide 1-40, 0.5mg
list price/quantitytotal
$0.00
Thomas No.
C850X06
Mfr. No.
amp40-f1
Description
FITC Labeled ß-Amyloid Peptide 1-40, 1mg
list price/quantitytotal
$0.00
$0.00 (0 Items)
Product is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile. If you do not have a Thomas Business Account, please Contact Us and someone will respond with details on how to apply for a business account with us.

Write A Review